In Vivo EGFR-ECD Molecular Imaging Using [68Ga]- Labelling Anti-EGFR Affibody Molecule
NCT02916329 · Status: UNKNOWN · Phase: NA · Type: INTERVENTIONAL · Enrollment: 100
Last updated 2016-09-27
Summary
The investigators developed \[68Ga\]-labelling Anti-EGFR Affibody Molecule as a targeted molecular imaging agent for noninvasive and repeatable detecting EGFR-ECD expression status.
Conditions
- Molecular Imaging
Interventions
- OTHER
-
68Ga-NODAGA-Ac-Cys-ZEGFR:1907
68Ga-NODAGA-Ac-Cys-ZEGFR:1907 (Ac-Cys-ZEGFR:1907 : Ac-CVDNKFNKEMWAAWE EIRNLPNLN GWQMTAFIASLVDDPSQSANLLAEAKKLNDAQAPK-NH2)
Sponsors & Collaborators
-
Harbin Medical University
lead OTHER
Principal Investigators
-
Shen Baozhong, M.D. · The Fourth Hospital of Harbin Medical University
Study Design
- Allocation
- RANDOMIZED
- Purpose
- DIAGNOSTIC
- Masking
- SINGLE
- Model
- PARALLEL
Eligibility
- Min Age
- 18 Years
- Sex
- ALL
- Healthy Volunteers
- Yes
Timeline & Regulatory
- Start
- 2016-09-30
- Primary Completion
- 2016-10-31
- Completion
- 2018-09-30
Countries
- China
Study Locations
More Related Trials
-
Antitumor Activity and Safety of BEBT-109, a Novel EGFR Inhibitor, in Previously Treated NSCLC
NCT06001671 ·Status: COMPLETED ·Phase: PHASE1
-
Blood Sample Monitoring of Patients With EGFR Mutated Lung Cancer
NCT02284633 ·Status: UNKNOWN
-
Detection of EGFR Mutations in the Blood of Patients With Non-small Cell Lung Cancer: a Feasibility Study
NCT00717002 ·Status: COMPLETED
-
A Study to Predict Gefitinib' s Efficacy for Lung Cancer by Plasma Free Nucleic Acids EGFR Gene Mutation Test
NCT02738684 ·Status: UNKNOWN
-
e- Ab Sensor-based Real-time Detection of Mutant EGFR in Clinical Specimens From Patients of Non-small Cell Lung Cancer
NCT01359436 ·Status: UNKNOWN ·Phase: NA
-
IMRT and Timing in Combination With EGFRTKI for Stage IV Non-small-cell Lung Cancer
NCT03258671 ·Status: UNKNOWN ·Phase: NA
-
Plasma Exosomes Reveal the Efficacy of Targeted Therapy in Patients With EGFR Mutation in Lung Adenocarcinoma
NCT06730477 ·Status: ENROLLING_BY_INVITATION
-
First Line Gefitinib by FDG-PET Metabolic Response
NCT01510990 ·Status: UNKNOWN ·Phase: PHASE2
-
The Role of Positron Emission Tomography (PET) During Erlotinib Treatment for Non-small Cell Lung Cancer
NCT01000428 ·Status: UNKNOWN
-
A Non-interventional Survey on the EGFR (Epidermal Growth Factor Receptor) Mutation Status in Completely Resected Chinese Non-Small Cell Lung Cancer (NSCLC) Patients With Adenocarcinoma Histology
NCT01106781 ·Status: COMPLETED
-
CSF CTC-Capture-Guided EGFR-TKI and Bevacizumab Combination Therapy in EGFR-Mutant Advanced NSCLC
NCT06557096 ·Status: NOT_YET_RECRUITING ·Phase: EARLY_PHASE1
-
Early Changes in Positron Emissions Tomography (PET/CT) Scan as Predictors of Clinical Outcome in NSCLC Treated With EGFR Tyrosin Kinase Inhibitors (TKI)
NCT02043002 ·Status: COMPLETED ·Phase: NA
-
The Detection of EGFR Mutations in Liquid Based Cytology Samples
NCT04086680 ·Status: COMPLETED
-
A Study of Hypofractionated Radiotherapy for Limited Metastatic NSCLC Harboring Sensitizing EGFR Mutations After First Line TKI Therapy
NCT02788058 ·Status: UNKNOWN ·Phase: PHASE2
-
Mutations in the Epidermal Growth Factor Receptor(EGFR) Gene in Non-Small Cell Lung Carcinoma (NSCLC) and the Relation to Response of Treatment With Erlotinib
NCT00815971 ·Status: UNKNOWN
-
Understanding Mechanisms of Acquired Resistance to BIBW2992
NCT01074177 ·Status: COMPLETED ·Phase: NA
-
Analysis of Re-biopsy Specimens in Advanced NSCLC With Acquired Resistance of EGFR-TKI Targeted Therapy
NCT03309462 ·Status: COMPLETED ·Phase: NA
-
Exploring Cancer Evolution, Prognostic and Predictive Biomarkers in EGFR-mutant NSCLC
NCT05997719 ·Status: RECRUITING
-
Neoadjuvant Erlotinib for Operable Stage II or IIIA NSCLC With EGFR Mutations
NCT01470716 ·Status: UNKNOWN ·Phase: PHASE2
-
Icotinib in Non-small Cell Lung Cancer Patients With Uncommon EGFR Mutation
NCT02961270 ·Status: UNKNOWN ·Phase: PHASE2
-
Evaluation of EGFR TKI Resistance Mechanism Using Plasma DNA Analysis
NCT01776684 ·Status: UNKNOWN ·Phase: NA
-
PRe-Operative Gefitinib in Resectable EGFR Mutation Positive Lung Cancer With Sector Sequencing for Biomarker Discovery
NCT02804776 ·Status: COMPLETED ·Phase: PHASE2
-
EGFR-TKI Resistance Profile in Chinese Patients With Advanced EGFRm+ NSCLC
NCT02988141 ·Status: UNKNOWN
-
C11-Erlotinib PET/CT as a Tool for Identification and Characterization of Tumor With High Expression of Epidermal Growth Factor Receptor(EGFR).
NCT01717807 ·Status: UNKNOWN
-
A Retrospective Molecular Epidemiology Study in Singapore Patients With Advanced Non Small Cell Lung Cancer (NSCLC) of Adenocarcinoma Histology to Assess Epidermal Growth Factor Receptor (EGFR) Mutation Status
NCT01100827 ·Status: UNKNOWN