Dual Vaccine Trial in Myeloproliferative Neoplasms
NCT04051307 · Status: COMPLETED · Phase: PHASE1/PHASE2 · Type: INTERVENTIONAL · Enrollment: 9
Last updated 2023-07-13
Summary
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and clinical effect.
Conditions
- Polycythemia Vera
- Essential Thrombocythemia
Interventions
- DRUG
-
PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL
Peptide vaccination
- DRUG
-
Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
Peptide vaccination
Sponsors & Collaborators
-
Inge Marie Svane
lead OTHER
Principal Investigators
-
Jacob H Grauslund, MD · CENTER FOR CANCER IMMUNE THERAPY, CCIT-DK
Study Design
- Allocation
- NA
- Purpose
- TREATMENT
- Masking
- NONE
- Model
- SINGLE_GROUP
Eligibility
- Min Age
- 18 Years
- Sex
- ALL
- Healthy Volunteers
- No
Timeline & Regulatory
- Start
- 2019-07-10
- Primary Completion
- 2022-07-10
- Completion
- 2022-07-10
Countries
- Denmark
Study Locations
More Related Trials
-
Safety and Efficacy of (PN-152,243)/PN-196,444 in the Prevention of Thrombocytopenia
NCT00037791 ·Status: COMPLETED ·Phase: PHASE3
-
A Phase 2 Study to Evaluate the Efficacy and Safety of AMG531 in Aplastic Anemia
NCT02094417 ·Status: COMPLETED ·Phase: PHASE2
-
A Prospective, One-arm and Open Clinical Study of Obinutuzumab in the Treatment of Pediatric Primary Immune Thrombocytopenia (ITP)
NCT06094881 ·Status: RECRUITING ·Phase: PHASE2
-
A Phase 3 Study to Evaluate the Safety and Efficacy of Efgartigimod PH20 Subcutaneous in Adult Patients With Primary Immune Thrombocytopenia
NCT04812925 ·Status: ACTIVE_NOT_RECRUITING ·Phase: PHASE3
-
Use of Direct Oral Anticoagulants (DOACs) in Patients With Ph-negative Myeloproliferative Neoplasms
NCT04192916 ·Status: COMPLETED
-
A Clinical Study on the Efficacy and Safety of HBM9161 in Patients With ITP
NCT04428255 ·Status: COMPLETED ·Phase: PHASE2/PHASE3
-
A Study to Assess the Efficacy and Safety of Efgartigimod IV in Adult Participants With Primary Immune Thrombocytopenia
NCT06544499 ·Status: RECRUITING ·Phase: PHASE3
-
The Safety, Tolerability, Pharmacokinetics, and Preliminary Efficacy of HMPL-523 in Adult Subjects With Immune Thrombocytopenia (ITP)
NCT06291415 ·Status: WITHDRAWN ·Phase: PHASE1
-
Safety, Tolerability, and Efficacy of NVG-2089 in Participants With Immune Thrombocytopenia
NCT07095127 ·Status: RECRUITING ·Phase: PHASE2
-
A Randomized, Double-blind, Placebo-controlled, and Multi-center Clinical Study of CM313 in the Treatment of Immune Thrombocytopenia
NCT06199089 ·Status: ACTIVE_NOT_RECRUITING ·Phase: PHASE2
-
An Observational, Multicenter Study to Evaluate the Safety and Effectiveness of Hetrombopag in Patients With ITP or AA
NCT05333861 ·Status: NOT_YET_RECRUITING
-
Daclizumab to Treat Chronic Immune Thrombocytopenia
NCT00049725 ·Status: COMPLETED ·Phase: PHASE2
-
A Study of Efgartigimod IV in Participants From 12 Years to Less Than 18 Years of Age With Chronic Immune Thrombocytopenia (ITP)
NCT07194850 ·Status: RECRUITING ·Phase: PHASE2/PHASE3
-
A Study to Assess the Efficacy and Safety of Efgartigimod in Adult Patients With Primary Immune Thrombocytopenia (ITP).
NCT04188379 ·Status: COMPLETED ·Phase: PHASE3
-
Once-Daily Oral Avatrombopag Tablets Used in Subjects With Chronic Liver Diseases and Thrombocytopenia Prior to Elective Surgical or Diagnostic Procedures
NCT00914927 ·Status: COMPLETED ·Phase: PHASE2
-
A Study to Evaluate the Efficacy and Safety of Efgartigimod PH20 Subcutaneous in Adult Patients With Primary Immune Thrombocytopenia
NCT04687072 ·Status: COMPLETED ·Phase: PHASE3
-
A Phase Ib Clinical Study for rhTPO in the Treatment of Thrombocytopenia in Patients With Chronic Liver Disease
NCT05193201 ·Status: UNKNOWN ·Phase: PHASE1
-
to Evaluate the Efficacy and Safety of Eltrombopag for Immune Thrombocytopenia With Chronic HBV Infection
NCT03664518 ·Status: COMPLETED ·Phase: PHASE2
-
A Phase I Study of Monoclonal Antibody TB-402 in Healthy Male Volunteers
NCT00612196 ·Status: COMPLETED ·Phase: PHASE1
-
Anti-CD38 Monoclonal Antibody Versus Rituximab in the Management of Primary Immune Thrombocytopenia (ITP)
NCT07297563 ·Status: RECRUITING ·Phase: PHASE2
-
A Prospective, One-arm and Open Clinical Study of Obinutuzumab in the Treatment of Immune Thrombocytopenia
NCT05995054 ·Status: RECRUITING ·Phase: PHASE2
-
A First in HumanTrial to Evaluate The Safety, Tolerability, And Pharmacokinetics Of PF-06755347
NCT03275740 ·Status: TERMINATED ·Phase: PHASE1
-
Open Label Study to Evaluate the Activity of Imetelstat in Patients With Essential Thrombocythemia or Polycythemia Vera
NCT01243073 ·Status: COMPLETED ·Phase: PHASE2
-
Study of AKR-501 Tablets Taken Orally Once Daily for 28 Days in Patients With Chronic Idiopathic Thrombocytopenic Purpura (ITP)
NCT00441090 ·Status: COMPLETED ·Phase: PHASE2
-
Treatment of ITP With Rituximab and / or Accutane
NCT02757196 ·Status: UNKNOWN ·Phase: PHASE2